PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN29879.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 666aa    MW: 74156 Da    PI: 7.199
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN29879.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.71.1e-28452503152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  KHN29879.1 452 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 503
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291442523IPR003035RWP-RK domain
PfamPF020423.0E-24456503IPR003035RWP-RK domain
SuperFamilySSF542778.83E-22552646No hitNo description
Gene3DG3DSA:3.10.20.2401.0E-21557641No hitNo description
SMARTSM006662.6E-24558644IPR000270PB1 domain
PROSITE profilePS5174520.399558644IPR000270PB1 domain
PfamPF005643.0E-14559643IPR000270PB1 domain
CDDcd064073.84E-38559643No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MPMGKTTWWI GPKGPVSGSS SSVKERLVVA VGYLREYTKN NNAANVLIQI WVPIRRMTGL  60
LAIGLGPDES VSVAFPFPTN MNMNMKSNVN IRFFRSHEYP RIPYEYGSLA LPVFERGSGT  120
CLGVLQIVMP AARWDTINYL PQLDNNNNNN AFQGMIPGGV VKVFDEDEVY EASVNEMMEV  180
VRCVCKTQNV PLALTWAPCV QQLCVDCGHS RDENNYVSIV DRACFVGDGQ PQLLGFQEAC  240
SQHHLFRGQG IVGTAFTTAK PCFAMDITAF TKAEYPLSHH ANIFDLHSAV AIPLRTSSYP  300
HFDFVLEFFL PKHCPDHNLF LNSLSILLQQ ACPTFHLSAP IHDDVFTSLP SESQSQQASW  360
IAHMIDAQSQ HKDNGKGVCL SLDFLEEEPK EEFKVTTTHC NWDTTATSTY HSHDHVVFSD  420
FGEESQSQSQ SQTHTFGVKR GRKPGEKRRT KAEKTISLPV LRQYFAGSLK DAAKSIGVCP  480
TTLKRICRQH GITRWPSRKI KKVGHSLKKL QLVIDSVQGA EGAIQIGSFY NSFPELSSRA  540
SQSSSPAAQS PPHVPQQPLR VKATFADEKI RFSLQPLWGF TELQLEISRR FNLSDVSNAN  600
NVVLKYLDDD GEWVVLACDG DLEECKDLHT TSQSRTIRLA LFQASPLNNQ PNSYTFANTT  660
STPSSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518588.10.0PREDICTED: protein NLP2-like
SwissprotQ7X9B91e-140NLP2_ARATH; Protein NLP2
TrEMBLI1JJW00.0I1JJW0_SOYBN; Uncharacterized protein
STRINGGLYMA02G48080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-131Nin-like family protein